PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009597904.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 730aa    MW: 80318 Da    PI: 5.9525
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009597904.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.3e-1859114156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t+ q++e+e++F+++++p+ ++r+eL k+l L+  qVk+WFqN+R+++k
  XP_009597904.1  59 KKRYHRHTQLQIQEMESFFKECPHPDDKQRKELGKRLVLEPLQVKFWFQNKRTQMK 114
                     688999***********************************************998 PP

2START216.87.6e-682484681206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela +a++el+++a+ +ep+W +s+    e +  +e++++f+++ +      ++ea+r+s+vv+m++ +lve+l+d++ qW+  +a    +a tl
  XP_009597904.1 248 ELAVAAMEELIRMAQTGEPLWILSPdnstETLCVEEYMRTFPRGIGpqplgLKSEASRESAVVIMNHINLVEILMDVN-QWTSVFAglvsRAVTL 341
                     57899********************666666666899999*99999********************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     ev+s+g      galq+m+ae+q++splvp R+ +fvRy++ + +g+w++vdvS+d+ ++ ++     R++++pSg+li++++ng+skvtw+eh+
  XP_009597904.1 342 EVLSTGvagnynGALQVMTAEFQVPSPLVPtRENYFVRYCKHHADGTWAVVDVSLDNLRPTST----SRCRRRPSGCLIQELPNGYSKVTWIEHI 432
                     ************************************************************875....9*************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++r +h+++r+lv+sgla+gak+wvatl+rqce+
  XP_009597904.1 433 EVDDRAVHNIYRPLVNSGLAFGAKRWVATLDRQCER 468
                     **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-2140114IPR009057Homeodomain-like
SuperFamilySSF466893.72E-1741116IPR009057Homeodomain-like
PROSITE profilePS5007115.62956116IPR001356Homeobox domain
SMARTSM003891.5E-1457120IPR001356Homeobox domain
PfamPF000461.7E-1559114IPR001356Homeobox domain
CDDcd000866.87E-1659117No hitNo description
PROSITE profilePS5084846.387239471IPR002913START domain
SuperFamilySSF559615.04E-38239470No hitNo description
CDDcd088752.40E-129243467No hitNo description
SMARTSM002341.8E-67248468IPR002913START domain
PfamPF018522.4E-57249468IPR002913START domain
Gene3DG3DSA:3.30.530.202.4E-6333468IPR023393START-like domain
SuperFamilySSF559619.62E-27488722No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    Send to blast
MFQPNMFESH HHLLDMSHKS PENELDIIRD DEFDTKSGTD IMENPSGDDQ DPNQRPNKKK  60
RYHRHTQLQI QEMESFFKEC PHPDDKQRKE LGKRLVLEPL QVKFWFQNKR TQMKAQHERH  120
ENSQLRNENE KLRAENIRYK EALGNATCPN CGGPAAIGEM SFDEQHLRIE NARLREEIDR  180
ISGIAAKYVG KPMLTYPNLP STGSTRSLDL GVSSFGPQTG LVGEMYSASD LLRSVSGPTD  240
ADKPIIIELA VAAMEELIRM AQTGEPLWIL SPDNSTETLC VEEYMRTFPR GIGPQPLGLK  300
SEASRESAVV IMNHINLVEI LMDVNQWTSV FAGLVSRAVT LEVLSTGVAG NYNGALQVMT  360
AEFQVPSPLV PTRENYFVRY CKHHADGTWA VVDVSLDNLR PTSTSRCRRR PSGCLIQELP  420
NGYSKVTWIE HIEVDDRAVH NIYRPLVNSG LAFGAKRWVA TLDRQCERLA SAMANNIPTG  480
DIGVITSPEG RRSMLKLAER MVMSFCAGVG ASTAHTWTTL SGSGADDVRV MTRKSIDDPG  540
RPPGIVLSAA TSFWLPVPPK RVFDFLRDEN SRSEWDILSN GGLVQEMAHI ANGRDPGNCV  600
SLLRVNSGNS SQSNMLILQE SSTDSTGSYV IYAPVDIVAM NVVLSGGDPD YVALLPSGFA  660
ILPDGSTSSH CGGNNVVEVG NGGSLLTVAF QILVDSVPTA KLSLGSVATV NSLIKCTVER  720
IKTAVVCDNA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754423e-88HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597904.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A0V0IVG00.0A0A0V0IVG0_SOLCH; Putative homeobox-leucine zipper protein MERISTEM L1-like
STRINGVIT_10s0116g00680.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9322491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2